PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK24646.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family Trihelix
Protein Properties Length: 325aa    MW: 38628.2 Da    PI: 6.7647
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK24646.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.81.9e-2550132186
    trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                 +W+ +e+++L+ +r+e+++++ ++k++k lWe v++km+++gf rsp+qCk+kw+nl +ryk+++++e +     ++++p++++++
  KFK24646.1  50 QWSIDETKQLLGIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSPEQCKSKWKNLVTRYKACETTEPEA---IRQQFPFYNEIQ 132
                 7********************************************************************85...56689****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.004847109IPR001005SANT/Myb domain
PfamPF138379.9E-2149134No hitNo description
CDDcd122038.06E-2249111No hitNo description
PROSITE profilePS500907.8451107IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MDRRNPFQHH HHPHQLHHLI QHQQQLPPPP QSTTAMDPGG GVVGGERVPQ WSIDETKQLL  60
GIREELDQTF METKRNKLLW EVVAAKMADK GFVRSPEQCK SKWKNLVTRY KACETTEPEA  120
IRQQFPFYNE IQAIFAARMQ RMLWSEATEP STSSKRKHHN FSSDEEEDEE ELDEPNQDIN  180
EELLSLVETH KKETEVITPS TSTNPRKRAK KGKGVTSGTR AETASNTLKE ILEDFMRQTV  240
KMEKEWRDAW EIKERERDRR EKEWRRRMAE LEEERAATER RWMEREEERR LREEARAQKR  300
DTLIDALLNK LTRDHDDNPH HQGRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A3e-1346130286DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2716770.0AY271677.1 Arabidopsis thaliana transcription factor GT-3a (GT3A) mRNA, complete cds.
GenBankBT0289260.0BT028926.1 Arabidopsis thaliana At5g01380 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195758.11e-154trihelix transcription factor GT-3a
SwissprotQ9SDW01e-156TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A087G4440.0A0A087G444_ARAAL; Uncharacterized protein
STRINGAT5G01380.11e-154(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-140Trihelix family protein